Lineage for d1uqub_ (1uqu B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142411Family c.87.1.6: Trehalose-6-phosphate synthase, OtsA [82540] (2 protein domains)
    family 20 glycosyltransferase; good structural similarity in the active site to the Oligosaccharide phosphorylases
    automatically mapped to Pfam PF00982
  6. 2142412Protein Trehalose-6-phosphate synthase, OtsA [82541] (1 species)
  7. 2142413Species Escherichia coli [TaxId:562] [82542] (3 PDB entries)
  8. 2142417Domain d1uqub_: 1uqu B: [99797]
    complexed with upg

Details for d1uqub_

PDB Entry: 1uqu (more details), 2 Å

PDB Description: trehalose-6-phosphate from e. coli bound with udp-glucose.
PDB Compounds: (B:) alpha, alpha-trehalose-phosphate synthase

SCOPe Domain Sequences for d1uqub_:

Sequence, based on SEQRES records: (download)

>d1uqub_ c.87.1.6 (B:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]}
srlvvvsnriappdehaasagglavgilgalkaagglwfgwsgetgnedqplkkvkkgni
twasfnlseqdldeyynqfsnavlwpafhyrldlvqfqrpawdgylrvnalladkllpll
qdddiiwihdyhllpfahelrkrgvnnrigfflhipfptpeifnalptydtlleqlcdyd
llgfqtendrlafldclsnltrvttrsakshtawgkafrtevypigiepkeiakqaagpl
ppklaqlkaelknvqnifsverldyskglperflayeallekypqhhgkirytqiaptsr
gdvqayqdirhqleneagringkygqlgwtplyylnqhfdrkllmkifrysdvglvtplr
dgmnlvakeyvaaqdpanpgvlvlsqfagaaneltsalivnpydrdevaaaldraltmsl
aerisrhaemldvivkndinhwqecfisdlkqivpr

Sequence, based on observed residues (ATOM records): (download)

>d1uqub_ c.87.1.6 (B:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]}
srlvvvsnriapagglavgilgalkaagglwfgwsgetgnedqplkkvkkgnitwasfnl
seqdldeyynqfsnavlwpafhyrldlvqfqrpawdgylrvnalladkllpllqdddiiw
ihdyhllpfahelrkrgvnnrigfflhipfptpeifnalptydtlleqlcdydllgfqte
ndrlafldclsnltrvttrsakshtawgkafrtevypigiepkeiakqaagplppklaql
kaelknvqnifsverldyskglperflayeallekypqhhgkirytqiaptsrgdvqayq
dirhqleneagringkygqlgwtplyylnqhfdrkllmkifrysdvglvtplrdgmnlva
keyvaaqdpanpgvlvlsqfagaaneltsalivnpydrdevaaaldraltmslaerisrh
aemldvivkndinhwqecfisdlkqivpr

SCOPe Domain Coordinates for d1uqub_:

Click to download the PDB-style file with coordinates for d1uqub_.
(The format of our PDB-style files is described here.)

Timeline for d1uqub_: