Lineage for d1uqsa1 (1uqs A:184-283)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654498Protein CD1, alpha-3 domain [88615] (3 species)
  7. 654505Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (3 PDB entries)
  8. 654508Domain d1uqsa1: 1uqs A:184-283 [99791]
    Other proteins in same PDB: d1uqsa2, d1uqsb_
    complexed with gmm

Details for d1uqsa1

PDB Entry: 1uqs (more details), 3.1 Å

PDB Description: the crystal structure of human cd1b with a bound bacterial glycolipid
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOP Domain Sequences for d1uqsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uqsa1 b.1.1.2 (A:184-283) CD1, alpha-3 domain {Human (Homo sapiens), CD1b [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywgpgsgg

SCOP Domain Coordinates for d1uqsa1:

Click to download the PDB-style file with coordinates for d1uqsa1.
(The format of our PDB-style files is described here.)

Timeline for d1uqsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uqsa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1uqsb_