Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) |
Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins) automatically mapped to Pfam PF01220 |
Protein Type II 3-dehydroquinate dehydratase [52306] (6 species) |
Species Actinobacillus pleuropneumoniae [TaxId:715] [102243] (1 PDB entry) |
Domain d1uqra_: 1uqr A: [99779] complexed with so4, trs |
PDB Entry: 1uqr (more details), 1.7 Å
SCOPe Domain Sequences for d1uqra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uqra_ c.23.13.1 (A:) Type II 3-dehydroquinate dehydratase {Actinobacillus pleuropneumoniae [TaxId: 715]} mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva kgvicglgakgydyaldfaiselqki
Timeline for d1uqra_: