![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.193: GRIP domain [101282] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.193.1: GRIP domain [101283] (1 family) ![]() |
![]() | Family a.193.1.1: GRIP domain [101284] (1 protein) |
![]() | Protein Golgi autoantigen, golgin-245 [101285] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101286] (2 PDB entries) |
![]() | Domain d1upth_: 1upt H: [99774] Other proteins in same PDB: d1upta_, d1uptc_, d1upte_, d1uptg_ complexed with gtp, mg |
PDB Entry: 1upt (more details), 1.7 Å
SCOPe Domain Sequences for d1upth_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1upth_ a.193.1.1 (H:) Golgi autoantigen, golgin-245 {Human (Homo sapiens) [TaxId: 9606]} geptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarl
Timeline for d1upth_: