Lineage for d1uptg_ (1upt G:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 829946Protein ADP-ribosylation factor [52614] (14 species)
  7. 829982Species Human (Homo sapiens), ARL1 [TaxId:9606] [102364] (2 PDB entries)
  8. 829986Domain d1uptg_: 1upt G: [99773]
    Other proteins in same PDB: d1uptb_, d1uptd_, d1uptf_, d1upth_
    complexed with gtp, mg

Details for d1uptg_

PDB Entry: 1upt (more details), 1.7 Å

PDB Description: structure of a complex of the golgin-245 grip domain with arl1
PDB Compounds: (G:) ADP-ribosylation factor-like protein 1

SCOP Domain Sequences for d1uptg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uptg_ c.37.1.8 (G:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}
gshmtremrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlgg
ltsirpywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdm
eqamtssemanslglpalkdrkwqifktsatkgtgldeamewlvetlksr

SCOP Domain Coordinates for d1uptg_:

Click to download the PDB-style file with coordinates for d1uptg_.
(The format of our PDB-style files is described here.)

Timeline for d1uptg_: