SCOP 1.75: Domain d1upne2: 1upn E:67-129

Lineage for d1upne2 (1upn E:67-129)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
   Pfam PF00084

6. Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90173] (18 PDB entries)

8. Domain d1upne2: 1upn E:67-129 [99765]
   Other proteins in same PDB: d1upn.1, d1upna_, d1upnc_
   modules 3 and 4

Details for d1upne2

PDB Entry: 1upn

PDB Description: complex of echovirus type 12 with domains 3 and 4 of its receptor decay accelerating factor (cd55) by cryo electron microscopy at 16 a

PDB Compounds: (E:) complement decay-accelerating factor

SCOP Domain Sequences for d1upne2:

Sequence; same for both SEQRES and ATOM records:

>d1upne2 g.18.1.1 (E:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
iycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpppe
crg

Timeline for d1upne2:

• d1upne2 first appeared in SCOP 1.67
  
• d1upne2 appears in SCOP 1.73
  
• d1upne2 appears in SCOPe 2.01
  
• d1upne2 appears in the current release, SCOPe 2.08