SCOP 1.67: Domain d1upne1: 1upn E:5-66

Lineage for d1upne1 (1upn E:5-66)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (9 proteins)

6. Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90173] (14 PDB entries)

8. Domain d1upne1: 1upn E:5-66 [99764]
   Other proteins in same PDB: d1upn.1, d1upna_, d1upnc_

Details for d1upne1

PDB Entry: 1upn, 16 Å

PDB Description: complex of echovirus type 12 with domains 3 and 4 of its receptor decay accelerating factor (cd55) by cryo electron microscopy at 16 a

SCOP Domain Sequences for d1upne1:

Sequence; same for both SEQRES and ATOM records:

>d1upne1 g.18.1.1 (E:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens)}
kscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdplpec
re

Timeline for d1upne1:

• d1upne1 is new in SCOP 1.67
  
• d1upne1 appears in SCOP 1.69
  
• d1upne1 appears in the current release, SCOPe 2.08