Lineage for d1upne1 (1upn E:5-66)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [90173] (19 PDB entries)
  8. Domain d1upne1: 1upn E:5-66 [99764]
    Other proteins in same PDB: d1upn.1, d1upna_, d1upnc_
    modules 3 and 4

Details for d1upne1

PDB Entry: 1upn (more details), 16 Å

PDB Description: complex of echovirus type 12 with domains 3 and 4 of its receptor decay accelerating factor (cd55) by cryo electron microscopy at 16 a
PDB Compounds: (E:) complement decay-accelerating factor

SCOPe Domain Sequences for d1upne1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upne1 g.18.1.1 (E:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
kscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdplpec
re

SCOPe Domain Coordinates for d1upne1 are not available.

Timeline for d1upne1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1upne2
View in 3D
Domains from other chains:
(mouse over for more information)
d1upn.1, d1upn.1, d1upna_, d1upnc_