Lineage for d1upna_ (1upn A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 382736Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 382819Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families) (S)
  5. 382820Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (9 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 382840Protein Human enterovirus B coat proteins [88635] (4 species)
  7. 382853Species Human echovirus 11 [TaxId:12078] [74890] (2 PDB entries)
  8. 382858Domain d1upna_: 1upn A: [99762]
    Other proteins in same PDB: d1upne1, d1upne2

Details for d1upna_

PDB Entry: 1upn (more details), 16 Å

PDB Description: complex of echovirus type 12 with domains 3 and 4 of its receptor decay accelerating factor (cd55) by cryo electron microscopy at 16 a

SCOP Domain Sequences for d1upna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upna_ b.121.4.1 (A:) Human enterovirus B coat proteins {Human echovirus 11}
gdvveavenavarvadtigsgpsnsqavpaltavetghtsqvtpsdtvqtrhvknyhsrs
essienflsrsacvymgeyhttnsdqtklfaswtisarrmvqmrrkleiftyvrfdvevt
fvitskqdqgtqlgqdmpplthqimyippggpipksvtdytwqtstnpsifwtegnappr
msipfisignaysnfydgwshfsqngvygyntlnhmgqiyvrhvngssplpmtstvrmyf
kpkhvkawvprpprlcqyknastvnfsptditdkrnsityipdtvkpdv

SCOP Domain Coordinates for d1upna_:

Click to download the PDB-style file with coordinates for d1upna_.
(The format of our PDB-style files is described here.)

Timeline for d1upna_: