SCOPe 2.08: Domain d1upna_: 1upn A:

Lineage for d1upna_ (1upn A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Human enterovirus B coat proteins [88635] (4 species)

7. Species Human echovirus 11 [TaxId:12078] [74890] (3 PDB entries)

8. Domain d1upna_: 1upn A: [99762]
   Other proteins in same PDB: d1upne1, d1upne2

Details for d1upna_

PDB Entry: 1upn, 16 Å

PDB Description: complex of echovirus type 12 with domains 3 and 4 of its receptor decay accelerating factor (cd55) by cryo electron microscopy at 16 a

PDB Compounds: (A:) echovirus 11 coat protein vp1

SCOPe Domain Sequences for d1upna_:

Sequence; same for both SEQRES and ATOM records:

>d1upna_ b.121.4.1 (A:) Human enterovirus B coat proteins {Human echovirus 11 [TaxId: 12078]}
gdvveavenavarvadtigsgpsnsqavpaltavetghtsqvtpsdtvqtrhvknyhsrs
essienflsrsacvymgeyhttnsdqtklfaswtisarrmvqmrrkleiftyvrfdvevt
fvitskqdqgtqlgqdmpplthqimyippggpipksvtdytwqtstnpsifwtegnappr
msipfisignaysnfydgwshfsqngvygyntlnhmgqiyvrhvngssplpmtstvrmyf
kpkhvkawvprpprlcqyknastvnfsptditdkrnsityipdtvkpdv

Timeline for d1upna_:

• d1upna_ first appeared in SCOP 1.67
  
• d1upna_ appears in SCOPe 2.07