Class a: All alpha proteins [46456] (286 folds) |
Fold a.61: Retroviral matrix proteins [47835] (1 superfamily) 4-5 helices; right-handed superhelix |
Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) the 5th, C-terminal helix is missing in some of the member structures |
Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins) automatically mapped to Pfam PF00540 |
Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species) topologically similar to one subunit in the interferon-gamma intertwined dimer |
Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (10 PDB entries) |
Domain d1upha_: 1uph A: [99756] myristoylated protein |
PDB Entry: 1uph (more details)
SCOPe Domain Sequences for d1upha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1upha_ a.61.1.1 (A:) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1 [TaxId: 11676]} xgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqi lgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaa dtgnnsqvsqny
Timeline for d1upha_: