Lineage for d1upcf3 (1upc F:375-572)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483377Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 483378Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 483525Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (7 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 483551Protein Carboxyethylarginine synthase [102335] (1 species)
  7. 483552Species Streptomyces clavuligerus [TaxId:1901] [102336] (3 PDB entries)
  8. 483566Domain d1upcf3: 1upc F:375-572 [99755]
    Other proteins in same PDB: d1upca1, d1upca2, d1upcb1, d1upcb2, d1upcc1, d1upcc2, d1upcd1, d1upcd2, d1upce1, d1upce2, d1upcf1, d1upcf2

Details for d1upcf3

PDB Entry: 1upc (more details), 2.45 Å

PDB Description: carboxyethylarginine synthase from streptomyces clavuligerus

SCOP Domain Sequences for d1upcf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upcf3 c.36.1.9 (F:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus}
petyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsag
cssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtng
lielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpfl
ievpvnydfqpggfgals

SCOP Domain Coordinates for d1upcf3:

Click to download the PDB-style file with coordinates for d1upcf3.
(The format of our PDB-style files is described here.)

Timeline for d1upcf3: