| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
| Protein Carboxyethylarginine synthase [102290] (1 species) |
| Species Streptomyces clavuligerus [TaxId:1901] [102291] (6 PDB entries) |
| Domain d1upcf1: 1upc F:198-374 [99753] Other proteins in same PDB: d1upca2, d1upca3, d1upcb2, d1upcb3, d1upcc2, d1upcc3, d1upcd2, d1upcd3, d1upce2, d1upce3, d1upcf2, d1upcf3 complexed with mg, so4, tpp |
PDB Entry: 1upc (more details), 2.45 Å
SCOPe Domain Sequences for d1upcf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1upcf1 c.31.1.3 (F:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
vadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiakgvl
pvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekktvr
isptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad
Timeline for d1upcf1: