Lineage for d1upcd3 (1upc D:375-572)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472772Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2472773Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2473068Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 2473135Protein Carboxyethylarginine synthase [102335] (1 species)
  7. 2473136Species Streptomyces clavuligerus [TaxId:1901] [102336] (6 PDB entries)
  8. 2473156Domain d1upcd3: 1upc D:375-572 [99749]
    Other proteins in same PDB: d1upca1, d1upca2, d1upcb1, d1upcb2, d1upcc1, d1upcc2, d1upcd1, d1upcd2, d1upce1, d1upce2, d1upcf1, d1upcf2
    complexed with mg, so4, tpp

Details for d1upcd3

PDB Entry: 1upc (more details), 2.45 Å

PDB Description: carboxyethylarginine synthase from streptomyces clavuligerus
PDB Compounds: (D:) carboxyethylarginine synthase

SCOPe Domain Sequences for d1upcd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upcd3 c.36.1.9 (D:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
petyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsag
cssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtng
lielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpfl
ievpvnydfqpggfgals

SCOPe Domain Coordinates for d1upcd3:

Click to download the PDB-style file with coordinates for d1upcd3.
(The format of our PDB-style files is described here.)

Timeline for d1upcd3: