Lineage for d1upcd1 (1upc D:198-374)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392797Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 392798Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 392816Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (7 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 392842Protein Carboxyethylarginine synthase [102290] (1 species)
  7. 392843Species Streptomyces clavuligerus [TaxId:1901] [102291] (3 PDB entries)
  8. 392855Domain d1upcd1: 1upc D:198-374 [99747]
    Other proteins in same PDB: d1upca2, d1upca3, d1upcb2, d1upcb3, d1upcc2, d1upcc3, d1upcd2, d1upcd3, d1upce2, d1upce3, d1upcf2, d1upcf3

Details for d1upcd1

PDB Entry: 1upc (more details), 2.45 Å

PDB Description: carboxyethylarginine synthase from streptomyces clavuligerus

SCOP Domain Sequences for d1upcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upcd1 c.31.1.3 (D:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus}
vadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiakgvl
pvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekktvr
isptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad

SCOP Domain Coordinates for d1upcd1:

Click to download the PDB-style file with coordinates for d1upcd1.
(The format of our PDB-style files is described here.)

Timeline for d1upcd1: