Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology automatically mapped to Pfam PF02776 |
Protein Carboxyethylarginine synthase [102330] (1 species) |
Species Streptomyces clavuligerus [TaxId:1901] [102331] (6 PDB entries) |
Domain d1upcc2: 1upc C:12-197 [99745] Other proteins in same PDB: d1upca1, d1upca3, d1upcb1, d1upcb3, d1upcc1, d1upcc3, d1upcd1, d1upcd3, d1upce1, d1upce3, d1upcf1, d1upcf3 complexed with mg, so4, tpp |
PDB Entry: 1upc (more details), 2.45 Å
SCOPe Domain Sequences for d1upcc2:
Sequence, based on SEQRES records: (download)
>d1upcc2 c.36.1.5 (C:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppantp akpvgv
>d1upcc2 c.36.1.5 (C:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidnppantpakpv gv
Timeline for d1upcc2: