Lineage for d1upcc2 (1upc C:12-197)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483377Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 483378Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 483379Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (7 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
  6. 483405Protein Carboxyethylarginine synthase [102330] (1 species)
  7. 483406Species Streptomyces clavuligerus [TaxId:1901] [102331] (3 PDB entries)
  8. 483417Domain d1upcc2: 1upc C:12-197 [99745]
    Other proteins in same PDB: d1upca1, d1upca3, d1upcb1, d1upcb3, d1upcc1, d1upcc3, d1upcd1, d1upcd3, d1upce1, d1upce3, d1upcf1, d1upcf3

Details for d1upcc2

PDB Entry: 1upc (more details), 2.45 Å

PDB Description: carboxyethylarginine synthase from streptomyces clavuligerus

SCOP Domain Sequences for d1upcc2:

Sequence, based on SEQRES records: (download)

>d1upcc2 c.36.1.5 (C:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppantp
akpvgv

Sequence, based on observed residues (ATOM records): (download)

>d1upcc2 c.36.1.5 (C:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidnppantpakpv
gv

SCOP Domain Coordinates for d1upcc2:

Click to download the PDB-style file with coordinates for d1upcc2.
(The format of our PDB-style files is described here.)

Timeline for d1upcc2: