![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
![]() | Protein Carboxyethylarginine synthase [102290] (1 species) |
![]() | Species Streptomyces clavuligerus [TaxId:1901] [102291] (6 PDB entries) |
![]() | Domain d1upcc1: 1upc C:198-374 [99744] Other proteins in same PDB: d1upca2, d1upca3, d1upcb2, d1upcb3, d1upcc2, d1upcc3, d1upcd2, d1upcd3, d1upce2, d1upce3, d1upcf2, d1upcf3 complexed with mg, so4, tpp |
PDB Entry: 1upc (more details), 2.45 Å
SCOPe Domain Sequences for d1upcc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1upcc1 c.31.1.3 (C:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} vadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiakgvl pvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekktvr isptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad
Timeline for d1upcc1: