SCOP 1.67: Domain d1upbd2: 1upb D:12-197

Lineage for d1upbd2 (1upb D:12-197)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (7 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology

6. Protein Carboxyethylarginine synthase [102330] (1 species)

7. Species Streptomyces clavuligerus [TaxId:1901] [102331] (3 PDB entries)

8. Domain d1upbd2: 1upb D:12-197 [99736]
   Other proteins in same PDB: d1upba1, d1upba3, d1upbb1, d1upbb3, d1upbc1, d1upbc3, d1upbd1, d1upbd3
   complexed with mg, so4, tpp

Details for d1upbd2

PDB Entry: 1upb, 2.35 Å

PDB Description: carboxyethylarginine synthase from streptomyces clavuligerus

SCOP Domain Sequences for d1upbd2:

Sequence, based on SEQRES records:

>d1upbd2 c.36.1.5 (D:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppantp
akpvgv

Sequence, based on observed residues (ATOM records):

>d1upbd2 c.36.1.5 (D:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidtnppantpakp
vgv

Timeline for d1upbd2:

• d1upbd2 is new in SCOP 1.67
  
• d1upbd2 appears in SCOP 1.69
  
• d1upbd2 appears in the current release, SCOPe 2.08