Lineage for d1upbc3 (1upb C:375-563)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828800Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 828801Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 829076Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 829129Protein Carboxyethylarginine synthase [102335] (1 species)
  7. 829130Species Streptomyces clavuligerus [TaxId:1901] [102336] (6 PDB entries)
  8. 829145Domain d1upbc3: 1upb C:375-563 [99734]
    Other proteins in same PDB: d1upba1, d1upba2, d1upbb1, d1upbb2, d1upbc1, d1upbc2, d1upbd1, d1upbd2

Details for d1upbc3

PDB Entry: 1upb (more details), 2.35 Å

PDB Description: carboxyethylarginine synthase from streptomyces clavuligerus
PDB Compounds: (C:) carboxyethylarginine synthase

SCOP Domain Sequences for d1upbc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upbc3 c.36.1.9 (C:375-563) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
petyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsag
cssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtng
lielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpfl
ievpvnydf

SCOP Domain Coordinates for d1upbc3:

Click to download the PDB-style file with coordinates for d1upbc3.
(The format of our PDB-style files is described here.)

Timeline for d1upbc3: