Lineage for d1upbc2 (1upb C:12-197)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592643Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1592644Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1592645Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 1592693Protein Carboxyethylarginine synthase [102330] (1 species)
  7. 1592694Species Streptomyces clavuligerus [TaxId:1901] [102331] (6 PDB entries)
  8. 1592709Domain d1upbc2: 1upb C:12-197 [99733]
    Other proteins in same PDB: d1upba1, d1upba3, d1upbb1, d1upbb3, d1upbc1, d1upbc3, d1upbd1, d1upbd3
    complexed with mg, so4, tpp

Details for d1upbc2

PDB Entry: 1upb (more details), 2.35 Å

PDB Description: carboxyethylarginine synthase from streptomyces clavuligerus
PDB Compounds: (C:) carboxyethylarginine synthase

SCOPe Domain Sequences for d1upbc2:

Sequence, based on SEQRES records: (download)

>d1upbc2 c.36.1.5 (C:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppantp
akpvgv

Sequence, based on observed residues (ATOM records): (download)

>d1upbc2 c.36.1.5 (C:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidppantpakpvg
v

SCOPe Domain Coordinates for d1upbc2:

Click to download the PDB-style file with coordinates for d1upbc2.
(The format of our PDB-style files is described here.)

Timeline for d1upbc2: