![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
![]() | Protein Carboxyethylarginine synthase [102290] (1 species) |
![]() | Species Streptomyces clavuligerus [TaxId:1901] [102291] (6 PDB entries) |
![]() | Domain d1upba1: 1upb A:198-374 [99726] Other proteins in same PDB: d1upba2, d1upba3, d1upbb2, d1upbb3, d1upbc2, d1upbc3, d1upbd2, d1upbd3 complexed with mg, so4, tpp |
PDB Entry: 1upb (more details), 2.35 Å
SCOPe Domain Sequences for d1upba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1upba1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} vadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiakgvl pvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekktvr isptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad
Timeline for d1upba1: