Lineage for d1upac3 (1upa C:375-563)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828800Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 828801Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 829076Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 829129Protein Carboxyethylarginine synthase [102335] (1 species)
  7. 829130Species Streptomyces clavuligerus [TaxId:1901] [102336] (6 PDB entries)
  8. 829141Domain d1upac3: 1upa C:375-563 [99722]
    Other proteins in same PDB: d1upaa1, d1upaa2, d1upab1, d1upab2, d1upac1, d1upac2, d1upad1, d1upad2

Details for d1upac3

PDB Entry: 1upa (more details), 2.35 Å

PDB Description: carboxyethylarginine synthase from streptomyces clavuligerus (semet structure)
PDB Compounds: (C:) carboxyethylarginine synthase

SCOP Domain Sequences for d1upac3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upac3 c.36.1.9 (C:375-563) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
petyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsag
cssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtng
lielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpfl
ievpvnydf

SCOP Domain Coordinates for d1upac3:

Click to download the PDB-style file with coordinates for d1upac3.
(The format of our PDB-style files is described here.)

Timeline for d1upac3: