| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (7 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
| Protein Carboxyethylarginine synthase [102335] (1 species) |
| Species Streptomyces clavuligerus [TaxId:1901] [102336] (3 PDB entries) |
| Domain d1upac3: 1upa C:375-563 [99722] Other proteins in same PDB: d1upaa1, d1upaa2, d1upab1, d1upab2, d1upac1, d1upac2, d1upad1, d1upad2 |
PDB Entry: 1upa (more details), 2.35 Å
SCOP Domain Sequences for d1upac3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1upac3 c.36.1.9 (C:375-563) Carboxyethylarginine synthase {Streptomyces clavuligerus}
petyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsag
cssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtng
lielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpfl
ievpvnydf
Timeline for d1upac3: