SCOP 1.69: Domain d1upaa2: 1upa A:12-197

Lineage for d1upaa2 (1upa A:12-197)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (7 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology

6. Protein Carboxyethylarginine synthase [102330] (1 species)

7. Species Streptomyces clavuligerus [TaxId:1901] [102331] (3 PDB entries)

8. Domain d1upaa2: 1upa A:12-197 [99715]
   Other proteins in same PDB: d1upaa1, d1upaa3, d1upab1, d1upab3, d1upac1, d1upac3, d1upad1, d1upad3

Details for d1upaa2

PDB Entry: 1upa, 2.35 Å

PDB Description: carboxyethylarginine synthase from streptomyces clavuligerus (semet structure)

SCOP Domain Sequences for d1upaa2:

Sequence, based on SEQRES records:

>d1upaa2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppantp
akpvgv

Sequence, based on observed residues (ATOM records):

>d1upaa2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidtnppantpakp
vgv

Timeline for d1upaa2:

• d1upaa2 first appeared in SCOP 1.67
  
• d1upaa2 appears in SCOP 1.71
  
• d1upaa2 appears in the current release, SCOPe 2.08