Lineage for d1upaa1 (1upa A:198-374)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392797Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 392798Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 392816Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (7 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 392842Protein Carboxyethylarginine synthase [102290] (1 species)
  7. 392843Species Streptomyces clavuligerus [TaxId:1901] [102291] (3 PDB entries)
  8. 392844Domain d1upaa1: 1upa A:198-374 [99714]
    Other proteins in same PDB: d1upaa2, d1upaa3, d1upab2, d1upab3, d1upac2, d1upac3, d1upad2, d1upad3

Details for d1upaa1

PDB Entry: 1upa (more details), 2.35 Å

PDB Description: carboxyethylarginine synthase from streptomyces clavuligerus (semet structure)

SCOP Domain Sequences for d1upaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upaa1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus}
vadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiakgvl
pvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekktvr
isptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad

SCOP Domain Coordinates for d1upaa1:

Click to download the PDB-style file with coordinates for d1upaa1.
(The format of our PDB-style files is described here.)

Timeline for d1upaa1: