Lineage for d1up8c_ (1up8 C:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359568Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily)
    multihelical; core: 5-helical bundle; binds cofactor at the beginning of third helix
  4. 359569Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (3 families) (S)
  5. 359583Family a.111.1.2: Haloperoxidase (bromoperoxidase) [48321] (1 protein)
    contains one core bundle; forms dimer
  6. 359584Protein Haloperoxidase (bromoperoxidase) [48322] (3 species)
  7. 359595Species Red algae (Corallina pilulifera) [TaxId:78447] [101380] (1 PDB entry)
  8. 359598Domain d1up8c_: 1up8 C: [99712]

Details for d1up8c_

PDB Entry: 1up8 (more details), 2.2 Å

PDB Description: recombinant vanadium-dependent bromoperoxidase from red algae corallina pilulifera

SCOP Domain Sequences for d1up8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1up8c_ a.111.1.2 (C:) Haloperoxidase (bromoperoxidase) {Red algae (Corallina pilulifera)}
gipadnlqsrakasfdtrvaaaelalnrgvvpsfangeellyrnpdpdntdpsfiasftk
glphddngaiidpddflafvrainsgdekeiadltlgpardpetglpiwrsdlanslele
vrgwenssagltfdlegpdaqsiamppapvltspelvaeiaelylmalgreiefsefdsp
knaeyiqfaidqlnglewfntpaklgdppaeirrrrgevtvgnlfrgilpgsevgpylsq
yiivgskqigsatvgnktlvspnaadefdgeiaygsitisqrvriatpgrdfmtdlkvfl
dvqdaadfrgfesyepgarlirtirdlatwvhfdalyeaylnaclillangvpfdpnlpf
qqedkldnqdvfvnfgsahvlslvtevatralkavryqkfnihrrlrpeatgglisvnki
aaqkgesifpevdlaveelgdilekaeisnrkqniadgdpdpdpsfllpmafaegspfhp
sygsghavvagacvtilkaffdsgieidqvfevdkdedklvkssfkgtltvagelnklad
niaigrnmagvhyfsdqfeslllgeqvaigileeqsltygenfffnlpkfdgttiqi

SCOP Domain Coordinates for d1up8c_:

Click to download the PDB-style file with coordinates for d1up8c_.
(The format of our PDB-style files is described here.)

Timeline for d1up8c_: