Lineage for d1uoya_ (1uoy A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 621450Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 622565Superfamily g.3.19: Bubble protein [103565] (1 family) (S)
  5. 622566Family g.3.19.1: Bubble protein [103566] (1 protein)
  6. 622567Protein Bubble protein [103567] (1 species)
  7. 622568Species Penicillium brevicompactum [TaxId:5074] [103568] (1 PDB entry)
  8. 622569Domain d1uoya_: 1uoy A: [99709]

Details for d1uoya_

PDB Entry: 1uoy (more details), 1.5 Å

PDB Description: the bubble protein from penicillium brevicompactum dierckx exudate.

SCOP Domain Sequences for d1uoya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uoya_ g.3.19.1 (A:) Bubble protein {Penicillium brevicompactum}
dtcgsgynvdqrrtnsgckagngdrhfcgcdrtgvveckggkwtevqdcgsssckgtsng
gatc

SCOP Domain Coordinates for d1uoya_:

Click to download the PDB-style file with coordinates for d1uoya_.
(The format of our PDB-style files is described here.)

Timeline for d1uoya_: