Lineage for d1uoua2 (1uou A:101-373)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106674Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2106675Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2106676Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 protein domains)
  6. 2106723Protein Thymidine phosphorylase [52420] (2 species)
  7. 2106733Species Human (Homo sapiens) [TaxId:9606] [102268] (1 PDB entry)
  8. 2106734Domain d1uoua2: 1uou A:101-373 [99707]
    Other proteins in same PDB: d1uoua1, d1uoua3
    complexed with cmu

Details for d1uoua2

PDB Entry: 1uou (more details), 2.11 Å

PDB Description: crystal structure of human thymidine phosphorylase in complex with a small molecule inhibitor
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d1uoua2:

Sequence, based on SEQRES records: (download)

>d1uoua2 c.27.1.1 (A:101-373) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
qlewpeawrqqlvdkhstggvgdkvslvlapalaacgckvpmisgrglghtggtldkles
ipgfnviqspeqmqvlldqagccivgqseqlvpadgilyaardvtatvdslplitasils
kklveglsalvvdvkfggaavfpnqeqarelaktlvgvgaslglrvaaaltamdkplgrc
vghaleveeallcmdgagppdlrdlvttlggallwlsghagtqaqgaarvaaalddgsal
grfermlaaqgvdpglaralcsgspaerrqllp

Sequence, based on observed residues (ATOM records): (download)

>d1uoua2 c.27.1.1 (A:101-373) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
qlewpeawrqqlvdkhstggvgdkvslvlapalaacgckvpmisgrglghtggtldkles
ipgfnviqspeqmqvlldqagccivgqseqlvpadgilyaardvtatvdslplitasils
kklveglsalvvdvkfgavfpnqeqarelaktlvgvgaslglrvaaaltamdkplgrcvg
haleveeallcmdgagppdlrdlvttlggallwlsghagtqaqgaarvaaalddgsalgr
fermlaaqgvdpglaralcsgspaerrqllp

SCOPe Domain Coordinates for d1uoua2:

Click to download the PDB-style file with coordinates for d1uoua2.
(The format of our PDB-style files is described here.)

Timeline for d1uoua2: