Lineage for d1uotp1 (1uot P:5-66)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429210Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 429211Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 429212Family g.18.1.1: Complement control module/SCR domain [57536] (9 proteins)
  6. 429282Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)
  7. 429283Species Human (Homo sapiens) [TaxId:9606] [90173] (14 PDB entries)
  8. 429348Domain d1uotp1: 1uot P:5-66 [99704]

Details for d1uotp1

PDB Entry: 1uot (more details), 3 Å

PDB Description: human cd55 domains 3 & 4

SCOP Domain Sequences for d1uotp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uotp1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens)}
kscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdplpec
re

SCOP Domain Coordinates for d1uotp1:

Click to download the PDB-style file with coordinates for d1uotp1.
(The format of our PDB-style files is described here.)

Timeline for d1uotp1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uotp2