SCOP 1.67: Domain d1uoqa2: 1uoq A:431-710

Lineage for d1uoqa2 (1uoq A:431-710)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (30 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (1 protein)
   N-terminal domain is a 7-bladed beta-propeller

6. Protein Prolyl oligopeptidase, C-terminal domain [53497] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [53498] (14 PDB entries)

8. Domain d1uoqa2: 1uoq A:431-710 [99703]
   Other proteins in same PDB: d1uoqa1
   complexed with gol; mutant

Details for d1uoqa2

PDB Entry: 1uoq, 2.1 Å

PDB Description: prolyl oligopeptidase from porcine brain, s554a mutant with bound peptide ligand glu-phe-ser-pro

SCOP Domain Sequences for d1uoqa2:

Sequence; same for both SEQRES and ATOM records:

>d1uoqa2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa)}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
ngganggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkaghgagkptakvieevsdmfafiarclnidwip

Timeline for d1uoqa2:

• d1uoqa2 is new in SCOP 1.67
  
• d1uoqa2 appears in SCOP 1.69
  
• d1uoqa2 appears in the current release, SCOPe 2.08