Lineage for d1uoqa1 (1uoq A:1-430)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.69: 7-bladed beta-propeller [50964] (12 superfamilies)
consists of seven 4-stranded beta-sheet motifs; meander
Superfamily b.69.7: Prolyl oligopeptidase, N-terminal domain [50993] (1 family) 
Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (1 protein) Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species) Species Pig (Sus scrofa) [TaxId:9823] [50996] (14 PDB entries) 
Domain d1uoqa1: 1uoq A:1-430 [99702]
Other proteins in same PDB: d1uoqa2
complexed with gol; mutant
Details for d1uoqa1
PDB Entry: 1uoq (more details), 2.1 Å
PDB Description: prolyl oligopeptidase from porcine brain, s554a mutant with bound peptide ligand glu-phe-ser-pro
SCOP Domain Sequences for d1uoqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uoqa1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa)}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtvkgi
SCOP Domain Coordinates for d1uoqa1:
Click to download the PDB-style file with coordinates for d1uoqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uoqa1:
- d1uoqa1 is new in SCOP 1.67
- d1uoqa1 appears in SCOP 1.69
- d1uoqa1 appears in the current release, SCOPe 2.08
View in 3D
