Lineage for d1uopa1 (1uop A:1-430)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066277Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2066278Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (2 protein domains)
    automatically mapped to Pfam PF02897
  6. 2066279Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species)
  7. 2066280Species Pig (Sus scrofa) [TaxId:9823] [50996] (27 PDB entries)
    Uniprot P23687
  8. 2066296Domain d1uopa1: 1uop A:1-430 [99700]
    Other proteins in same PDB: d1uopa2
    complexed with gol; mutant

Details for d1uopa1

PDB Entry: 1uop (more details), 1.85 Å

PDB Description: prolyl oligopeptidase from porcine brain, s554a mutant with bound peptide ligand gly-phe-glu-pro
PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d1uopa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uopa1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtvkgi

SCOPe Domain Coordinates for d1uopa1:

Click to download the PDB-style file with coordinates for d1uopa1.
(The format of our PDB-style files is described here.)

Timeline for d1uopa1: