Lineage for d1uooa1 (1uoo A:1-430)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675262Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 675454Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (2 families) (S)
  5. 675455Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (1 protein)
  6. 675456Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species)
  7. 675457Species Pig (Sus scrofa) [TaxId:9823] [50996] (16 PDB entries)
  8. 675473Domain d1uooa1: 1uoo A:1-430 [99698]
    Other proteins in same PDB: d1uooa2
    complexed with gol; mutant

Details for d1uooa1

PDB Entry: 1uoo (more details), 2.35 Å

PDB Description: prolyl oligopeptidase from porcine brain, s554a mutant with bound peptide ligand gly-phe-arg-pro
PDB Compounds: (A:) prolyl endopeptidase

SCOP Domain Sequences for d1uooa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uooa1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtvkgi

SCOP Domain Coordinates for d1uooa1:

Click to download the PDB-style file with coordinates for d1uooa1.
(The format of our PDB-style files is described here.)

Timeline for d1uooa1: