Lineage for d1uooa1 (1uoo A:1-430)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.69: 7-bladed beta-propeller [50964] (12 superfamilies)
consists of seven 4-stranded beta-sheet motifs; meander
Superfamily b.69.7: Prolyl oligopeptidase, N-terminal domain [50993] (1 family) 
Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (1 protein) Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species) Species Pig (Sus scrofa) [TaxId:9823] [50996] (14 PDB entries) 
Domain d1uooa1: 1uoo A:1-430 [99698]
Other proteins in same PDB: d1uooa2
complexed with gol; mutant
Details for d1uooa1
PDB Entry: 1uoo (more details), 2.35 Å
PDB Description: prolyl oligopeptidase from porcine brain, s554a mutant with bound peptide ligand gly-phe-arg-pro
SCOP Domain Sequences for d1uooa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uooa1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa)}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtvkgi
SCOP Domain Coordinates for d1uooa1:
Click to download the PDB-style file with coordinates for d1uooa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uooa1:
- d1uooa1 is new in SCOP 1.67
- d1uooa1 appears in SCOP 1.69
- d1uooa1 appears in the current release, SCOPe 2.08
View in 3D
