Lineage for d1uola_ (1uol A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 368237Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 368422Superfamily b.2.5: p53-like transcription factors [49417] (6 families) (S)
  5. 368423Family b.2.5.2: p53 tumor suppressor, DNA-binding domain [81314] (1 protein)
  6. 368424Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 368425Species Human (Homo sapiens) [TaxId:9606] [49420] (6 PDB entries)
  8. 368426Domain d1uola_: 1uol A: [99695]

Details for d1uola_

PDB Entry: 1uol (more details), 1.9 Å

PDB Description: crystal structure of the human p53 core domain mutant m133l/v203a/n239y/n268d at 1.9 a resolution.

SCOP Domain Sequences for d1uola_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uola_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens)}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
vvvpyeppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvc
acpgrdrrteeenlr

SCOP Domain Coordinates for d1uola_:

Click to download the PDB-style file with coordinates for d1uola_.
(The format of our PDB-style files is described here.)

Timeline for d1uola_: