SCOP 1.69: Domain d1uoja_: 1uoj A:

Lineage for d1uoja_ (1uoj A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families)

5. Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein)
   a truncated form of this fold lacking one of the N-terminal strands

6. Protein PA-IL, galactose-binding lectin 1 [82023] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [82024] (3 PDB entries)

8. Domain d1uoja_: 1uoj A: [99691]

Details for d1uoja_

PDB Entry: 1uoj, 2.4 Å

PDB Description: crystal structure of pseudomonas aeruginosa lectin 1 in the calcium- free state

SCOP Domain Sequences for d1uoja_:

Sequence; same for both SEQRES and ATOM records:

>d1uoja_ b.18.1.16 (A:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

Timeline for d1uoja_:

• d1uoja_ first appeared in SCOP 1.67
  
• d1uoja_ appears in SCOP 1.71
  
• d1uoja_ appears in the current release, SCOPe 2.08