SCOP 1.69: Domain d1unsa2: 1uns A:121-236

Lineage for d1unsa2 (1uns A:121-236)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)

6. Protein Staphylococcal enterotoxin C2, SEC2 [54338] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54339] (8 PDB entries)

8. Domain d1unsa2: 1uns A:121-236 [99683]
   Other proteins in same PDB: d1unsa1

Details for d1unsa2

PDB Entry: 1uns, 2 Å

PDB Description: identification of a secondary zinc-binding site in staphylococcal enterotoxin c2: implications for superantigen recognition

SCOP Domain Sequences for d1unsa2:

Sequence; same for both SEQRES and ATOM records:

>d1unsa2 d.15.6.1 (A:121-236) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhltt

Timeline for d1unsa2:

• d1unsa2 first appeared in SCOP 1.67
  
• d1unsa2 appears in SCOP 1.71
  
• d1unsa2 appears in the current release, SCOPe 2.08