SCOPe 2.07: Domain d1unsa1: 1uns A:1-120

Lineage for d1unsa1 (1uns A:1-120)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Staphylococcal enterotoxin C2, SEC2 [50222] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50223] (8 PDB entries)

8. Domain d1unsa1: 1uns A:1-120 [99682]
   Other proteins in same PDB: d1unsa2
   complexed with zn

Details for d1unsa1

PDB Entry: 1uns, 2 Å

PDB Description: identification of a secondary zinc-binding site in staphylococcal enterotoxin c2: implications for superantigen recognition

PDB Compounds: (A:) enterotoxin type c-2

SCOPe Domain Sequences for d1unsa1:

Sequence; same for both SEQRES and ATOM records:

>d1unsa1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus [TaxId: 1280]}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg

Timeline for d1unsa1:

• d1unsa1 first appeared in SCOP 1.67
  
• d1unsa1 appears in SCOPe 2.06
  
• d1unsa1 appears in the current release, SCOPe 2.08