SCOPe 2.06: Domain d1unnc1: 1unn C:243-351

Lineage for d1unnc1 (1unn C:243-351)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DNA polymerase IV [103036] (1 species)

7. Species Escherichia coli [TaxId:562] [103037] (1 PDB entry)

8. Domain d1unnc1: 1unn C:243-351 [99680]
   Other proteins in same PDB: d1unna1, d1unna2, d1unna3, d1unnb1, d1unnb2, d1unnb3, d1unnc2, d1unnd2
   little finger domain only complexed with DNA polymerase III beta subunit
   protein/DNA complex; complexed with so4

Details for d1unnc1

PDB Entry: 1unn, 1.9 Å

PDB Description: complex of beta-clamp processivity factor and little finger domain of poliv

PDB Compounds: (C:) DNA polymerase IV

SCOPe Domain Sequences for d1unnc1:

Sequence; same for both SEQRES and ATOM records:

>d1unnc1 d.240.1.1 (C:243-351) DNA polymerase IV {Escherichia coli [TaxId: 562]}
vgvertmaedihhwseceaiierlypelerrlakvkpdlliarqgvklkfddfqqttqeh
vwprlnkadliatarktwderrggrgvrlvglhvtlldpqmerqlvlgl

Timeline for d1unnc1:

• d1unnc1 first appeared in SCOP 1.67, called d1unnc_
  
• d1unnc1 was called d1unnc_ in SCOPe 2.05
  
• d1unnc1 appears in SCOPe 2.07
  
• d1unnc1 appears in the current release, SCOPe 2.08