![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
![]() | Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) ![]() |
![]() | Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins) |
![]() | Protein DNA polymerase IV [103036] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [103037] (1 PDB entry) |
![]() | Domain d1unnc_: 1unn C: [99680] Other proteins in same PDB: d1unna1, d1unna2, d1unna3, d1unnb1, d1unnb2, d1unnb3 |
PDB Entry: 1unn (more details), 1.9 Å
SCOP Domain Sequences for d1unnc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1unnc_ d.240.1.1 (C:) DNA polymerase IV {Escherichia coli} hhvgvertmaedihhwseceaiierlypelerrlakvkpdlliarqgvklkfddfqqttq ehvwprlnkadliatarktwderrggrgvrlvglhvtlldpqmerqlvlgl
Timeline for d1unnc_: