Lineage for d1unnc_ (1unn C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516579Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 516580Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 516581Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 516614Protein DNA polymerase IV [103036] (1 species)
  7. 516615Species Escherichia coli [TaxId:562] [103037] (1 PDB entry)
  8. 516616Domain d1unnc_: 1unn C: [99680]
    Other proteins in same PDB: d1unna1, d1unna2, d1unna3, d1unnb1, d1unnb2, d1unnb3

Details for d1unnc_

PDB Entry: 1unn (more details), 1.9 Å

PDB Description: complex of beta-clamp processivity factor and little finger domain of poliv

SCOP Domain Sequences for d1unnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1unnc_ d.240.1.1 (C:) DNA polymerase IV {Escherichia coli}
hhvgvertmaedihhwseceaiierlypelerrlakvkpdlliarqgvklkfddfqqttq
ehvwprlnkadliatarktwderrggrgvrlvglhvtlldpqmerqlvlgl

SCOP Domain Coordinates for d1unnc_:

Click to download the PDB-style file with coordinates for d1unnc_.
(The format of our PDB-style files is described here.)

Timeline for d1unnc_: