![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (2 families) ![]() |
![]() | Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein) duplication: consists of three domains of this fold |
![]() | Protein DNA polymerase III, beta subunit [55981] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55982] (6 PDB entries) |
![]() | Domain d1unna2: 1unn A:123-244 [99675] Other proteins in same PDB: d1unnc_, d1unnd_ |
PDB Entry: 1unn (more details), 1.9 Å
SCOP Domain Sequences for d1unna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1unna2 d.131.1.1 (A:123-244) DNA polymerase III, beta subunit {Escherichia coli} qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm pigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgrfp dy
Timeline for d1unna2: