Lineage for d1un9b3 (1un9 B:171-335)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414157Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 414256Superfamily d.79.2: Tubulin/Dihydroxyacetone kinase C-terminal domain [55307] (2 families) (S)
  5. 414282Family d.79.2.2: Dihydroxyacetone kinase C-terminal domain [89983] (2 proteins)
  6. 414283Protein Dihydroxyacetone kinase [103079] (1 species)
    contains additional alpha-helical, ATP-binding domain
  7. 414284Species Citrobacter freundii [TaxId:546] [103080] (2 PDB entries)
  8. 414288Domain d1un9b3: 1un9 B:171-335 [99672]
    Other proteins in same PDB: d1un9a1, d1un9a2, d1un9b1, d1un9b2
    complexed with 2ha, anp, mg

Details for d1un9b3

PDB Entry: 1un9 (more details), 3.1 Å

PDB Description: crystal structure of the dihydroxyacetone kinase from c. freundii in complex with amp-pnp and mg2+

SCOP Domain Sequences for d1un9b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1un9b3 d.79.2.2 (B:171-335) Dihydroxyacetone kinase {Citrobacter freundii}
nlatvlreaqyaasntfslgvalsschlpqetdaaprhhpghaelgmgihgepgasvidt
qnsaqvvnlmvdkllaalpetgrlavminnlggvsvaemaiitrelassplhsridwlig
paslvtaldmkgfsltaivleesiekalltevetsnwptpvppre

SCOP Domain Coordinates for d1un9b3:

Click to download the PDB-style file with coordinates for d1un9b3.
(The format of our PDB-style files is described here.)

Timeline for d1un9b3:

  • d1un9b3 is new in SCOP 1.67
  • d1un9b3 does not appear in SCOP 1.69