Lineage for d1un8b1 (1un8 B:336-550)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450531Fold a.208: Citrobacter dihydroxyacetone kinase extra ATP-binding domain [101472] (1 superfamily)
    multihelical; bundle
  4. 450532Superfamily a.208.1: Citrobacter dihydroxyacetone kinase extra ATP-binding domain [101473] (1 family) (S)
  5. 450533Family a.208.1.1: Citrobacter dihydroxyacetone kinase extra ATP-binding domain [101474] (1 protein)
  6. 450534Protein Citrobacter dihydroxyacetone kinase extra ATP-binding domain [101475] (1 species)
    eight-helical up-and-down barrel with a central ligand-binding cavity
  7. 450535Species Citrobacter freundii [TaxId:546] [101476] (2 PDB entries)
  8. 450537Domain d1un8b1: 1un8 B:336-550 [99664]
    Other proteins in same PDB: d1un8a4, d1un8b4

Details for d1un8b1

PDB Entry: 1un8 (more details), 2.5 Å

PDB Description: crystal structure of the dihydroxyacetone kinase of c. freundii (native form)

SCOP Domain Sequences for d1un8b1:

Sequence, based on SEQRES records: (download)

>d1un8b1 a.208.1.1 (B:336-550) Citrobacter dihydroxyacetone kinase extra ATP-binding domain {Citrobacter freundii}
itcvvsshasarvefqpsanalvagivelvtatlsdlethlnaldakvgdgdtgstfaaa
areiasllhrqqlplnnlatlfaligerltvvmggssgvlmsifftaagqkleqganvve
alntglaqmkfyggadegdrtmidalqpaltsllaqpknlqaafdaaqagaertclsska
nagrasylssesllgnmdpgaqrlamvfkalaese

Sequence, based on observed residues (ATOM records): (download)

>d1un8b1 a.208.1.1 (B:336-550) Citrobacter dihydroxyacetone kinase extra ATP-binding domain {Citrobacter freundii}
itcvvsshasarvefqpsanalvagivelvtatlsdlethlnaldakvgdgdtgstfaaa
areiasllhrqqlplnnlatlfaligerltvvmggssgvlmsifftaagqkleqganvve
alntglaqmkfyggadegdrtmidalqpaltsllaqpknlqaafdaaqagaertclsska
naesllgnmdpgaqrlamvfkalaese

SCOP Domain Coordinates for d1un8b1:

Click to download the PDB-style file with coordinates for d1un8b1.
(The format of our PDB-style files is described here.)

Timeline for d1un8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1un8b4