Lineage for d1un7a1 (1un7 A:3-57,A:359-394)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811542Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 811543Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 811673Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein)
  6. 811674Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (3 species)
  7. 811675Species Bacillus subtilis [TaxId:1423] [102019] (1 PDB entry)
  8. 811676Domain d1un7a1: 1un7 A:3-57,A:359-394 [99657]
    Other proteins in same PDB: d1un7a2, d1un7b2

Details for d1un7a1

PDB Entry: 1un7 (more details), 2.05 Å

PDB Description: the 3-d structure of the n-acetylglucosamine-6-phosphate deacetylase, naga, from bacillus subtilis: a member of the urease superfamily
PDB Compounds: (A:) N-acetylglucosamine-6-phosphate deacetylase

SCOP Domain Sequences for d1un7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1un7a1 b.92.1.5 (A:3-57,A:359-394) N-acetylglucosamine-6-phosphate deacetylase, NagA {Bacillus subtilis [TaxId: 1423]}
esllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvllpXsvtv
gkdadlvivssdcevilticrgniafiskead

SCOP Domain Coordinates for d1un7a1:

Click to download the PDB-style file with coordinates for d1un7a1.
(The format of our PDB-style files is described here.)

Timeline for d1un7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1un7a2