Lineage for d1un6b3 (1un6 B:161-190)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1964751Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1964752Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1964753Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. Protein Transcription factor IIIA, TFIIIA [57693] (1 species)
    duplication: consists of 6 fingers
  7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [57694] (4 PDB entries)
  8. 1964816Domain d1un6b3: 1un6 B:161-190 [99651]
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d1un6b3

PDB Entry: 1un6 (more details), 3.1 Å

PDB Description: the crystal structure of a zinc finger - rna complex reveals two modes of molecular recognition
PDB Compounds: (B:) transcription factor iiia

SCOPe Domain Sequences for d1un6b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1un6b3 g.37.1.1 (B:161-190) Transcription factor IIIA, TFIIIA {African clawed frog (Xenopus laevis) [TaxId: 8355]}
gypckkddscsfvgktwtlylkhvaechqd

SCOPe Domain Coordinates for d1un6b3:

Click to download the PDB-style file with coordinates for d1un6b3.
(The format of our PDB-style files is described here.)

Timeline for d1un6b3: