Lineage for d1un2a_ (1un2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118739Family c.47.1.13: DsbA-like [100953] (4 protein domains)
    contains an all-alpha subdomain insertion
  6. 2118740Protein Disulfide-bond formation facilitator (DsbA) [100954] (4 species)
    the insert subdomain is a 4-helical bundle
  7. 2118750Species Escherichia coli [TaxId:562] [100955] (17 PDB entries)
  8. 2118780Domain d1un2a_: 1un2 A: [99645]
    circularly permuted cpdsba_q100t99

Details for d1un2a_

PDB Entry: 1un2 (more details), 2.4 Å

PDB Description: crystal structure of circularly permuted cpdsba_q100t99 preserved global fold and local structural adjustments
PDB Compounds: (A:) thiol-disulfide interchange protein

SCOPe Domain Sequences for d1un2a_:

Sequence, based on SEQRES records: (download)

>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]}
qtirsasdirdvfinagikgeeydaawnsfvvkslvaqqekaaadvqlrgvpamfvngky
qlnpqgmdtsnmdvfvqqyadtvkylsekkgggtgaqyedgkqyttlekpvagapqvlef
fsffcphcyqfeevlhisdnvkkklpegvkmtkyhvnfmggdlgkdltqawavamalgve
dkvtvplfegvqktl

Sequence, based on observed residues (ATOM records): (download)

>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]}
qtirsasdirdvfinagikgeeydaawnsfvvkslvaqqekaaadvqlrgvpamfvngky
qlnpqgmdtsnmdvfvqqyadtvkylseyedgkqyttlekpvagapqvleffsffcphcy
qfeevlhisdnvkkklpegvkmtkyhvnfmggdlgkdltqawavamalgvedkvtvplfe
gvqktl

SCOPe Domain Coordinates for d1un2a_:

Click to download the PDB-style file with coordinates for d1un2a_.
(The format of our PDB-style files is described here.)

Timeline for d1un2a_: