Lineage for d1un1b_ (1un1 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042910Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 protein domains)
    Pfam PF00722
    beta-Glucanase-like
  6. 2042981Protein Xyloglucan endotransglycosylase [101634] (1 species)
  7. 2042982Species European aspen (Populus tremula) [TaxId:113636] [101635] (2 PDB entries)
  8. 2042986Domain d1un1b_: 1un1 B: [99644]
    complexed with au

Details for d1un1b_

PDB Entry: 1un1 (more details), 2.1 Å

PDB Description: xyloglucan endotransglycosylase native structure.
PDB Compounds: (B:) xyloglucan endotransglycosylase

SCOPe Domain Sequences for d1un1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1un1b_ b.29.1.2 (B:) Xyloglucan endotransglycosylase {European aspen (Populus tremula) [TaxId: 113636]}
vafgrnyvptwafdhikyfnggneiqlhldkytgtgfqskgsylfghfsmqmklvpgdsa
gtvtafylssqnsehdeidfeflgnrtgqpyilqtnvftggkgdreqriylwfdptkefh
yysvlwnmymivflvddvpirvfknckdlgvkfpfnqpmkiysslwnaddwatrgglekt
dwskapfiasyrsfhidgceasveakfcatqgarwwdqkefqdldafqyrrlswvrqkyt
iynyctdrsrypsmppeckrdrdi

SCOPe Domain Coordinates for d1un1b_:

Click to download the PDB-style file with coordinates for d1un1b_.
(The format of our PDB-style files is described here.)

Timeline for d1un1b_: