Lineage for d1un1a_ (1un1 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663688Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (5 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 663726Protein Xyloglucan endotransglycosylase [101634] (1 species)
  7. 663727Species European aspen (Populus tremula) [TaxId:113636] [101635] (2 PDB entries)
  8. 663730Domain d1un1a_: 1un1 A: [99643]

Details for d1un1a_

PDB Entry: 1un1 (more details), 2.1 Å

PDB Description: xyloglucan endotransglycosylase native structure.
PDB Compounds: (A:) xyloglucan endotransglycosylase

SCOP Domain Sequences for d1un1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1un1a_ b.29.1.2 (A:) Xyloglucan endotransglycosylase {European aspen (Populus tremula) [TaxId: 113636]}
pvdvafgrnyvptwafdhikyfnggneiqlhldkytgtgfqskgsylfghfsmqmklvpg
dsagtvtafylssqnsehdeidfeflgnrtgqpyilqtnvftggkgdreqriylwfdptk
efhyysvlwnmymivflvddvpirvfknckdlgvkfpfnqpmkiysslwnaddwatrggl
ektdwskapfiasyrsfhidgceasveakfcatqgarwwdqkefqdldafqyrrlswvrq
kytiynyctdrsrypsmppeckrdrdi

SCOP Domain Coordinates for d1un1a_:

Click to download the PDB-style file with coordinates for d1un1a_.
(The format of our PDB-style files is described here.)

Timeline for d1un1a_: