Lineage for d1umyd_ (1umy D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090074Superfamily c.1.26: Homocysteine S-methyltransferase [82282] (1 family) (S)
  5. 2090075Family c.1.26.1: Homocysteine S-methyltransferase [82283] (3 protein domains)
    Pfam PF02574
  6. 2090076Protein Betaine-homocysteine S-methyltransferase [82284] (2 species)
  7. 2090082Species Norway rat (Rattus norvegicus) [TaxId:10116] [102107] (1 PDB entry)
  8. 2090086Domain d1umyd_: 1umy D: [99638]
    complexed with bme, zn

Details for d1umyd_

PDB Entry: 1umy (more details), 2.5 Å

PDB Description: bhmt from rat liver
PDB Compounds: (D:) betaine--homocysteine s-methyltransferase

SCOPe Domain Sequences for d1umyd_:

Sequence, based on SEQRES records: (download)

>d1umyd_ c.1.26.1 (D:) Betaine-homocysteine S-methyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
krgilerlnagevvigdggfvfalekrgyvkagpwtpeaavehpeavrqlhreflragsn
vmqtftfyasedklenrgnyvaekisgqkvneaacdiarqvadegdalvaggvsqtpsyl
scksetevkkifhqqlevfmkknvdfliaeyfehveeavwavealktsgkpiaatmcigp
egdlhgvspgecavrlvkagaaivgvnchfdpstslqtiklmkegleaarlkaylmsqpl
ayhtpdcgkqgfidlpefpfgleprvatrwdiqkyareaynlgvryiggccgfepyhira
iaeelapergflppasekhgswgsgldmhtkpwirararkeywqnlriasgrpynpsmsk
pdawgvtkgaaelmqqkeatteqqlralfekqkfks

Sequence, based on observed residues (ATOM records): (download)

>d1umyd_ c.1.26.1 (D:) Betaine-homocysteine S-methyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
krgilerlnagevvigdggfvfalekrgyvkagpwtpeaavehpeavrqlhreflragsn
vmqtftfyakisgqkvneaacdiarqvadegdalvaggvsqtpsylscksetevkkifhq
qlevfmkknvdfliaeyfehveeavwavealktsgkpiaatmcigpegdlhgvspgecav
rlvkagaaivgvnchfdpstslqtiklmkegleaarlkaylmsqplayhtpdcgkqgfid
lpefpfgleprvatrwdiqkyareaynlgvryiggccgfepyhiraiaeelapergflpp
asekhgswgsgldmhtkpwirararkeywqnlriasgrpynpsmskpdawgvtkgaaelm
qqkeatteqqlralfekqkfks

SCOPe Domain Coordinates for d1umyd_:

Click to download the PDB-style file with coordinates for d1umyd_.
(The format of our PDB-style files is described here.)

Timeline for d1umyd_: